Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Vvi4g233 ATGAATGATCTGATGACAAAATCGTTCATCAGCTATGTGGATCTGAAGAAGGAAGCCATGAAGGACTTGGAAGCGGGTCCTGAATATGATCTGCAGATGTCCGGAACCCAGATGGACAGGAACCTGGGTTTGTTCTTGGAGGAGGCCGAGAAGGTGAAGCAGGAGATGGGTTTGATTAGAGAGATTTTGGGGAGGCTGCATGAGGCCAATGAAGAGAGCAAAGCCATCAAGTCTCAGCTCGAGGAGATGGACCGCGCCAATGCTGCTAATATGAGGCTCTCAGGTTACAAAGAGGGTACTCCGGTGTACAGGACTAGGGCTGCGGTCACGAATGGGCTGAGGAAGAAGCTCAAGGAGCTGATGATGGACTTTCAGGGGCTGAGGCAGAGGATGATGACGGAGTACAAGGAGACGGTGGGGAGGCGGTATTTTACAGTGACAGGGGAGTACCCTGATGAGGAGGTGATAGAGAAGATTATATCGAATGGGGAAGGGGGTGAGGAGTTTTTGGGGAGGGCGATACAGGAGCATGGAAGAGGGAAGGTGTTGGAGACAGTGGTGGAGATACAGGACAGGCATGACGCGGCTAAGGAGATAGAGAAGAAATCTCAAGACTGCCAAAGACTACCAGAGGAGCAGCAGGAAGTGCATGTGTTTGGGTGTTATACTTCTGCTGATACTAATTCTTATAGTGGTCATCCCCATTGCTACCAGTTTTAG 720 50.42 MNDLMTKSFISYVDLKKEAMKDLEAGPEYDLQMSGTQMDRNLGLFLEEAEKVKQEMGLIREILGRLHEANEESKAIKSQLEEMDRANAANMRLSGYKEGTPVYRTRAAVTNGLRKKLKELMMDFQGLRQRMMTEYKETVGRRYFTVTGEYPDEEVIEKIISNGEGGEEFLGRAIQEHGRGKVLETVVEIQDRHDAAKEIEKKSQDCQRLPEEQQEVHVFGCYTSADTNSYSGHPHCYQF* 240
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
4 2303749 2304814 + Vvi4g233 Vvi4g233 785012

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Vvi4g233 239 Coils Coil 66 89 - -
Vvi4g233 239 CDD SynN 45 173 IPR006011 GO:0016020
Vvi4g233 239 PANTHER SYNTAXIN-RELATED PROTEIN KNOLLE 74 201 - -
Vvi4g233 239 PANTHER SYNTAXIN-RELATED PROTEIN KNOLLE 4 76 - -
Vvi4g233 239 SMART SynN_4 37 136 IPR006011 GO:0016020
Vvi4g233 239 Pfam Syntaxin 70 206 IPR006011 GO:0016020
Vvi4g233 239 Gene3D - 38 212 - -
Vvi4g233 239 SUPERFAMILY t-snare proteins 44 202 IPR010989 GO:0016020|GO:0016192
Vvi4g233 239 PANTHER SYNTAXIN 4 76 IPR045242 -
Vvi4g233 239 PANTHER SYNTAXIN 74 201 IPR045242 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Vvi4g233 K08486 STX1B_2_3; syntaxin 1B/2/3 - vvi:100254385 380.948
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g233 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Vvi4g377 ECH 1 341 SNARE and Associated Proteins AT3G24350 65.7 9.0e-107 384.0
Vvi11g384 ECH 1 339 SNARE and Associated Proteins AT3G24350 66.0 6.4e-105 377.9
Vvi4g233 . 1 201 SNARE and Associated Proteins AT1G08560 64.5 4.9e-69 258.5
Vvi4g990 ECH 1 259 SNARE and Associated Proteins AT2G18260 53.3 5.5e-73 271.6
Vvi12g501 . 24 282 SNARE and Associated Proteins AT3G11820 64.1 6.0e-91 331.3
Vvi12g501 . 1 282 SNARE and Associated Proteins AT3G52400 54.1 2.4e-77 286.2
Vvi12g501 . 1 297 SNARE and Associated Proteins AT4G03330 68.1 1.6e-104 376.3
Vvi8g156 . 1 285 SNARE and Associated Proteins AT4G03330 50.2 8.5e-66 247.7
Vvi12g501 . 1 297 SNARE and Associated Proteins AT1G61290 75.3 1.8e-116 416.0
Vvi12g501 . 1 297 SNARE and Associated Proteins AT1G11250 75.1 4.3e-115 411.4
Vvi8g156 . 1 308 SNARE and Associated Proteins AT3G03800 76.7 2.5e-118 422.2
Vvi12g523 . 97 399 SNARE and Associated Proteins AT3G03800 58.4 1.8e-87 319.7
Vvi8g156 . 1 203 SNARE and Associated Proteins AT5G08080 78.3 5.8e-80 294.3
Vvi12g523 . 97 302 SNARE and Associated Proteins AT5G08080 62.6 4.8e-58 221.5
Vvi16g114 ECH 1 262 SNARE and Associated Proteins AT5G16830 61.7 6.1e-79 291.2
Vvi2g709 ECH 1 262 SNARE and Associated Proteins AT5G16830 59.7 2.0e-77 286.2
Vvi2g709 ECH 1 262 SNARE and Associated Proteins AT5G46860 67.6 2.1e-84 309.3
Vvi16g114 ECH 1 262 SNARE and Associated Proteins AT5G46860 58.0 1.0e-67 253.8
Vvi14g1065 . 1 184 SNARE and Associated Proteins AT5G46860 58.5 1.1e-48 190.7
Vvi2g709 ECH 1 257 SNARE and Associated Proteins AT4G17730 63.0 3.0e-75 278.9
Vvi16g114 ECH 1 261 SNARE and Associated Proteins AT4G17730 52.6 2.6e-63 239.2
Vvi14g1065 . 1 184 SNARE and Associated Proteins AT4G17730 54.4 6.4e-46 181.4
Vvi2g709 ECH 65 256 SNARE and Associated Proteins AT1G32270 65.1 2.5e-58 223.0
Vvi16g114 ECH 14 260 SNARE and Associated Proteins AT1G32270 50.4 6.0e-52 201.8
Vvi13g19 . 61 396 SNARE and Associated Proteins AT5G05760 66.0 2.4e-114 409.1
Vvi4g377 ECH 1 341 SNARE and Associated Proteins AT3G24350 65.7 9.0e-107 384.0
Vvi11g384 ECH 1 339 SNARE and Associated Proteins AT3G24350 66.0 6.4e-105 377.9
Vvi14g133 ECH 1 328 SNARE and Associated Proteins AT5G26980 78.4 2.3e-130 462.2
Vvi7g353 ECH 1 319 SNARE and Associated Proteins AT5G26980 74.6 3.7e-120 428.3
Vvi7g353 ECH 1 316 SNARE and Associated Proteins AT4G02195 68.8 2.4e-111 399.1
Vvi14g133 ECH 1 326 SNARE and Associated Proteins AT4G02195 67.7 2.7e-110 395.6
Vvi14g133 ECH 1 328 SNARE and Associated Proteins AT3G05710 76.9 1.1e-130 463.4
Vvi7g353 ECH 1 319 SNARE and Associated Proteins AT3G05710 70.7 2.0e-116 416.0
Vvi19g583 . 3 233 SNARE and Associated Proteins AT1G16240 72.3 2.1e-88 322.4
Vvi19g583 . 2 233 SNARE and Associated Proteins AT1G79590 73.3 1.4e-88 323.2
Vvi5g1352 . 110 290 SNARE and Associated Proteins AT1G28490 70.2 1.8e-64 242.7
Vvi8g590 ECH 1 264 SNARE and Associated Proteins AT3G09740 79.3 9.5e-114 406.8
Vvi6g289 ECH 1 265 SNARE and Associated Proteins AT3G09740 70.9 2.8e-97 352.1
Vvi6g289 ECH 1 265 SNARE and Associated Proteins AT3G45280 68.3 4.2e-93 338.2
Vvi8g590 ECH 1 264 SNARE and Associated Proteins AT3G45280 66.3 5.7e-90 327.8
Vvi8g590 ECH 1 261 SNARE and Associated Proteins AT3G61450 70.1 2.3e-96 349.0
Vvi6g289 ECH 1 261 SNARE and Associated Proteins AT3G61450 63.6 1.8e-85 312.8
Vvi13g422 . 65 310 SNARE and Associated Proteins AT1G51740 75.8 2.0e-94 342.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32