Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Vvi4g589 ATGGCGGATCAATCTACCGATTCGAATCGGAAAACTCGAGTCTACCATCCATACCAAGACCTCCAGGTCCCCATCCAAAACCTCTACAACCTTCCCACCTCTCCCGAGTACCTCTTCGATGAAGAATCGCTTCATCAACGCCGCTCTTGGAGCGAGAATCTGCAATACTATACGGGGTCGGGTTACCTTTCCGGAGCCATAATCGGTGGCGCCAAGGGCTCCATCGAAGGGATCAGGGCGGCGGAGGCCGGCGACACGCTCAAACTCCGAGTCAACCGGGTTCTCAACTCCGGCGGCCAAACGGGTCGGAGGTTCGGCAACTCGATGGGCGTTCTTGGCCTTATTTTTTCCGGGTTGGAGAGCGGAATGATACACTGGAGAGACACCGATGATATGCTCAACAGCGTCTTCGCTGGTTTGGGCACCGGCGCTCTGTATCGAGCGGCTGCGGGGCCGCGCTCCGCCGTGATCGCTGGTGCTATCGGAGGTTTGGCTGCTGGCGCTGCCGTGGCCGGTAAGCAGGTCATGAAGCGATATGTTCCCATATGA 549 57.74 MADQSTDSNRKTRVYHPYQDLQVPIQNLYNLPTSPEYLFDEESLHQRRSWSENLQYYTGSGYLSGAIIGGAKGSIEGIRAAEAGDTLKLRVNRVLNSGGQTGRRFGNSMGVLGLIFSGLESGMIHWRDTDDMLNSVFAGLGTGALYRAAAGPRSAVIAGAIGGLAAGAAVAGKQVMKRYVPI* 183
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
4 6751662 6752535 - Vvi4g589 Vvi4g589 785368

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Vvi4g589 182 PANTHER TIM23 3 182 IPR045238 GO:0022857
Vvi4g589 182 Pfam Tim17/Tim22/Tim23/Pmp24 family 56 165 - -
Vvi4g589 182 PANTHER MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM23-3 3 182 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Vvi4g589 K17794 TIM23; mitochondrial import inner membrane translocase subunit TIM23 - vvi:100255976 331.643
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g589 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Vvi6g422 . 65 449 Chloroplast and Mitochondria Gene Families AT2G28800 68.1 1.3e-131 466.8
Vvi1g589 . 51 396 Chloroplast and Mitochondria Gene Families AT2G28800 56.1 3.3e-100 362.5
Vvi12g867 . 3 199 Chloroplast and Mitochondria Gene Families AT1G15820 58.1 3.0e-72 268.9
Vvi19g298 ECH 12 232 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 3.5e-96 348.6
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT3G27690 70.9 3.8e-87 318.5
Vvi7g460 . 17 184 Chloroplast and Mitochondria Gene Families AT3G27690 68.2 9.1e-81 297.4
Vvi18g26 . 102 323 Chloroplast and Mitochondria Gene Families AT3G27690 51.8 7.8e-56 214.5
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT3G27690 63.1 1.7e-55 213.4
Vvi12g46 ECH 15 148 Chloroplast and Mitochondria Gene Families AT3G27690 54.1 4.3e-54 208.8
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT3G27690 54.8 3.1e-52 202.6
Vvi1g1250 . 3 272 Chloroplast and Mitochondria Gene Families AT3G61470 80.4 6.0e-129 457.2
Vvi11g48 . 52 260 Chloroplast and Mitochondria Gene Families AT3G61470 67.0 2.1e-86 315.8
Vvi17g566 ECH 22 242 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 1.2e-65 246.9
Vvi13g497 . 1 153 Chloroplast and Mitochondria Gene Families AT3G54890 89.5 1.9e-80 295.8
Vvi18g26 . 28 329 Chloroplast and Mitochondria Gene Families AT1G76570 78.8 8.3e-144 506.9
Vvi15g2 . 1 208 Chloroplast and Mitochondria Gene Families AT1G61520 67.0 3.5e-95 345.1
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT2G05070 72.5 1.4e-96 349.7
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT2G05070 70.4 8.4e-86 313.9
Vvi7g460 . 17 184 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 1.5e-79 293.1
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT2G05070 63.1 2.0e-55 213.0
Vvi18g26 . 102 326 Chloroplast and Mitochondria Gene Families AT2G05070 51.6 5.9e-55 211.5
Vvi12g46 ECH 15 148 Chloroplast and Mitochondria Gene Families AT2G05070 54.1 5.0e-54 208.4
Vvi19g298 ECH 2 203 Chloroplast and Mitochondria Gene Families AT2G05100 71.4 4.8e-80 295.0
Vvi12g680 ECH 1 144 Chloroplast and Mitochondria Gene Families AT2G05100 66.2 1.8e-66 250.0
Vvi7g460 . 17 155 Chloroplast and Mitochondria Gene Families AT2G05100 63.9 2.9e-61 232.6
Vvi18g1777 . 72 259 Chloroplast and Mitochondria Gene Families AT2G05100 54.1 5.6e-44 175.3
Vvi10g365 . 22 120 Chloroplast and Mitochondria Gene Families AT2G05100 57.3 3.9e-37 152.5
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT1G29930 70.0 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT1G29930 71.4 7.2e-85 310.8
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT1G29930 63.7 1.5e-74 276.6
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT1G29930 57.4 3.6e-60 228.8
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT1G29930 65.6 1.7e-57 219.9
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29930 53.3 6.5e-54 208.0
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT1G29920 70.0 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT1G29920 71.4 7.2e-85 310.8
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT1G29920 63.7 1.5e-74 276.6
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT1G29920 57.4 3.6e-60 228.8
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT1G29920 65.6 1.7e-57 219.9
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29920 53.3 6.5e-54 208.0
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT1G29910 70.0 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT1G29910 71.4 7.2e-85 310.8
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT1G29910 63.7 1.5e-74 276.6
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT1G29910 57.4 3.6e-60 228.8
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT1G29910 65.6 1.7e-57 219.9
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29910 53.3 6.5e-54 208.0
Vvi18g1777 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 87.2 5.7e-141 497.3
Vvi19g298 ECH 13 219 Chloroplast and Mitochondria Gene Families AT4G10340 51.4 5.4e-51 198.4
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT2G34420 70.4 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT2G34420 72.3 4.9e-86 314.7
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT2G34420 63.2 2.5e-74 275.8
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT2G34420 57.9 1.2e-60 230.3
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT2G34420 66.1 9.7e-58 220.7
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT2G34420 52.9 1.9e-53 206.5
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT2G34430 71.1 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT2G34430 72.3 6.5e-86 314.3
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT2G34430 63.1 1.3e-73 273.5
Vvi12g46 ECH 13 148 Chloroplast and Mitochondria Gene Families AT2G34430 57.8 2.6e-58 222.6
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT2G34430 66.1 9.7e-58 220.7
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT2G34430 52.9 2.5e-53 206.1
Vvi18g26 . 109 323 Chloroplast and Mitochondria Gene Families AT2G34430 50.7 4.7e-52 201.8
Vvi14g1214 . 51 311 Chloroplast and Mitochondria Gene Families AT5G40810 91.2 2.6e-140 495.0
Vvi9g478 . 57 317 Chloroplast and Mitochondria Gene Families AT5G40810 90.0 9.9e-140 493.0
Vvi14g1214 . 1 311 Chloroplast and Mitochondria Gene Families AT3G27240 85.5 5.1e-151 530.8
Vvi9g478 . 30 317 Chloroplast and Mitochondria Gene Families AT3G27240 84.7 6.2e-141 497.3
Vvi6g700 ECH 1 323 Chloroplast and Mitochondria Gene Families AT2G30160 72.4 3.2e-135 478.4
Vvi8g316 ECH 2 110 Chloroplast and Mitochondria Gene Families AT2G30160 72.6 2.4e-42 169.9
Vvi6g700 ECH 1 323 Chloroplast and Mitochondria Gene Families AT1G07030 74.7 3.4e-137 485.0
Vvi8g316 ECH 1 110 Chloroplast and Mitochondria Gene Families AT1G07030 75.7 6.3e-43 171.8
Vvi7g348 . 1 309 Chloroplast and Mitochondria Gene Families AT2G47490 80.3 4.7e-144 507.7
Vvi1g346 . 14 320 Chloroplast and Mitochondria Gene Families AT2G47490 66.1 7.0e-116 414.1
Vvi1g346 . 12 366 Chloroplast and Mitochondria Gene Families AT1G25380 64.3 2.8e-124 442.2
Vvi7g348 . 9 301 Chloroplast and Mitochondria Gene Families AT1G25380 65.4 1.6e-108 389.8
Vvi12g644 . 1 576 Chloroplast and Mitochondria Gene Families AT4G21490 73.9 9.0e-250 859.8
Vvi12g645 . 1 578 Chloroplast and Mitochondria Gene Families AT4G21490 65.3 7.1e-223 770.4
Vvi4g589 . 7 178 Chloroplast and Mitochondria Gene Families AT1G17530 61.5 9.0e-55 210.3
Vvi4g589 . 11 183 Chloroplast and Mitochondria Gene Families AT3G04800 57.5 2.4e-50 195.7
Vvi4g589 . 2 183 Chloroplast and Mitochondria Gene Families AT1G72750 59.5 4.9e-56 214.5
Vvi1g249 ECH 11 243 Chloroplast and Mitochondria Gene Families AT1G26100 66.0 3.3e-81 298.5
Vvi14g922 ECH 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 72.7 2.3e-92 335.5
Vvi16g662 . 22 231 Chloroplast and Mitochondria Gene Families AT4G25570 68.0 2.7e-82 302.4
Vvi1g540 . 3 216 Chloroplast and Mitochondria Gene Families AT1G14730 52.8 8.4e-63 237.3
Vvi14g1108 ECH 1 273 Chloroplast and Mitochondria Gene Families AT5G14040 90.5 1.0e-145 513.5
Vvi17g35 ECH 1 274 Chloroplast and Mitochondria Gene Families AT5G14040 88.3 1.8e-142 502.7
Vvi3g302 . 6 296 Chloroplast and Mitochondria Gene Families AT5G14040 50.8 2.4e-86 316.2
Vvi7g1224 . 17 300 Chloroplast and Mitochondria Gene Families AT5G14040 50.3 4.7e-82 302.0
Vvi17g35 ECH 2 274 Chloroplast and Mitochondria Gene Families AT3G48850 79.9 9.3e-128 453.8
Vvi14g1108 ECH 2 272 Chloroplast and Mitochondria Gene Families AT3G48850 78.6 2.1e-127 452.6
Vvi7g1224 . 17 298 Chloroplast and Mitochondria Gene Families AT3G48850 51.7 2.6e-85 312.8
Vvi3g302 . 13 296 Chloroplast and Mitochondria Gene Families AT3G48850 52.1 7.4e-85 311.2
Vvi3g302 . 1 309 Chloroplast and Mitochondria Gene Families AT2G17270 73.2 2.8e-133 471.9
Vvi7g1224 . 7 300 Chloroplast and Mitochondria Gene Families AT2G17270 68.0 1.3e-117 419.9
Vvi14g1108 ECH 1 269 Chloroplast and Mitochondria Gene Families AT2G17270 51.3 4.1e-76 282.0
Vvi17g35 ECH 1 275 Chloroplast and Mitochondria Gene Families AT2G17270 50.7 2.0e-75 279.6
Vvi14g1007 . 16 318 Chloroplast and Mitochondria Gene Families AT5G15640 74.7 1.1e-127 453.4
Vvi5g230 . 19 319 Chloroplast and Mitochondria Gene Families AT5G15640 50.8 3.0e-82 302.4
Vvi4g138 . 1 193 Chloroplast and Mitochondria Gene Families AT5G26200 59.1 4.6e-68 255.4
Vvi4g138 . 1 198 Chloroplast and Mitochondria Gene Families AT1G72820 62.7 2.0e-74 276.6
Vvi2g29 ECH 91 294 Chloroplast and Mitochondria Gene Families AT5G52570 56.9 1.8e-55 213.0
Vvi16g754 ECH 1 188 Chloroplast and Mitochondria Gene Families AT5G52570 54.8 2.1e-48 189.5
Vvi2g29 ECH 48 213 Chloroplast and Mitochondria Gene Families AT4G25700 68.5 6.2e-66 247.7
Vvi16g754 ECH 1 104 Chloroplast and Mitochondria Gene Families AT4G25700 90.4 3.9e-52 201.8
Vvi19g292 . 19 359 Chloroplast and Mitochondria Gene Families AT5G54290 75.1 1.0e-126 450.3
Vvi11g848 . 87 574 Chloroplast and Mitochondria Gene Families AT2G18710 83.4 8.9e-231 796.6
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0011351 1 1 1 0 1 1 2 1 1 1 1 1 2 1 1 2 1 0 2 1 1 1 1 1 1 1 0 1 1 1 31