Gene search
Sequence information

Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Bpe12g00479 | ATGGATGCCATAGACTCAGTCGTCGATCCTCTCAGAGAGTTCGCCAAGGACAGCGTTCGCCTTGTCAAGAGGTGTCACAAGCCTGATCGCAAAGAATTCACAAAGGTTGCATTCCGTACGGCTGTCGGATTCGTTGTAATGGGATTCGTTGGATTCTTTGTGAAGCTGATTTTCATTCCGATCAATAACATAATTGTCGGATCTGGTTGA | 210 | 46.19 | MDAIDSVVDPLREFAKDSVRLVKRCHKPDRKEFTKVAFRTAVGFVVMGFVGFFVKLIFIPINNIIVGSG | 69 |
Gff information

Chromosome | Start | End | Strand | Old_gene | Gene | Num |
---|---|---|---|---|---|---|
12 | 10559664 | 10559996 | + | Bpe005741.1 | Bpe12g00479 | 112492 |
Annotation information

Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Bpe12g00479 | 69 | ProSitePatterns | Protein secE/sec61-gamma signature. | 14 | 42 | IPR001901 | GO:0006605|GO:0006886|GO:0016020 | |
Bpe12g00479 | 69 | SUPERFAMILY | Preprotein translocase SecE subunit | 4 | 65 | IPR023391 | - | |
Bpe12g00479 | 69 | PANTHER | PROTEIN TRANSPORT PROTEIN SEC61 SUBUNIT GAMMA-3 | 1 | 69 | - | - | |
Bpe12g00479 | 69 | Gene3D | Preprotein translocase SecE subunit | 7 | 68 | IPR023391 | - | |
Bpe12g00479 | 69 | Hamap | Protein translocase subunit SecE [secE]. | 9 | 64 | IPR001901 | GO:0006605|GO:0006886|GO:0016020 | |
Bpe12g00479 | 69 | TIGRFAM | secE_euk_arch: protein translocase SEC61 complex gamma subunit, archaeal and eukaryotic | 8 | 66 | IPR008158 | GO:0008320|GO:0015031|GO:0016020 | |
Bpe12g00479 | 69 | Pfam | SecE/Sec61-gamma subunits of protein translocation complex | 13 | 65 | IPR001901 | GO:0006605|GO:0006886|GO:0016020 | |
Bpe12g00479 | 69 | PANTHER | SEC61 GAMMA SUBUNIT | 1 | 69 | - | - |
Event-related genes

Select | Gene_1 | Gene_2 | Event_name |
---|---|---|---|
Bpe07g00892 | Bpe12g00479 | CCT | |
Bpe12g00479 | Bpe15g00222 | CCT | |
Bpe07g00892 | Bpe12g00479 | ECH | |
Bpe12g00479 | Bpe15g00222 | ECH | |
Bpe12g00479 | Bpe13g00200 | BCT |
Duplication type information

Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
---|---|---|---|---|---|---|
Bpe12g00479 | Bpe-Chr12:10559664 | Bpe13g00200 | Bpe-Chr13:9976332 | 1.25E-37 | dispersed | |
Bpe12g00479 | Bpe-Chr12:10559664 | Bpe07g00892 | Bpe-Chr7:14974056 | 9.09E-44 | wgd |
Pathway information

Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Bpe12g00479 | K07342 | - | jre:108994290 | 130.183 |