Gene search
Sequence information

Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Bpe15g00169 | ATGTGCCGGAGTGACGAAGTCGATGCGGTTGACCATCGTCTGAGTCTTTTATCAGAGGTTCGGCTTCCTGCAACCCCCGGCGACGACTCCGATGGAGATGGGGATGCCCTCTTCATTCCTCCTCTCAACTTCTCGGCCGTCGACGCCGGCATTTTTCGCTCCGGCTTCCCTCATGACGCAAACTTCTCTTTCATTCAAACCCTAGGCCTCCGCTCCATCATATACCTTTGTCCGGAGCCTTATCCTGATTCAAATATGGAGTTTCTCAAGTCTAATGGAATCAAATTGTATCAATTCGGCATCGAAGGACATAAGGAGCCATTTGTAAACATCCCAGAGAATAAAATTCGTGAAGCACTGAGAGTTGTTCTTGATTCAAGGAATCACCCGCTTCTAATTCACTGTAAACGAGGAAAGCATCGAACTGGTTGTTTGGTGGGATGCCTGAGGAAAATGCAGAGATGGTGCTTATCGTCTGTATTTTCTGAGTACCAGCGATTTGCAGCGGCTAAAGCTAGAGTTTCTGATCAGAGGTTCATTGAAGTTTTTGATGTTTCTGCCTTAAAACCATCTTCCCATGACTCTTCCTAG | 591 | 46.87 | MCRSDEVDAVDHRLSLLSEVRLPATPGDDSDGDGDALFIPPLNFSAVDAGIFRSGFPHDANFSFIQTLGLRSIIYLCPEPYPDSNMEFLKSNGIKLYQFGIEGHKEPFVNIPENKIREALRVVLDSRNHPLLIHCKRGKHRTGCLVGCLRKMQRWCLSSVFSEYQRFAAAKARVSDQRFIEVFDVSALKPSSHDSS | 196 |
Gff information

Chromosome | Start | End | Strand | Old_gene | Gene | Num |
---|---|---|---|---|---|---|
15 | 12184162 | 12185720 | + | Bpe001106.1 | Bpe15g00169 | 115848 |
Annotation information

Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Bpe15g00169 | 196 | CDD | PFA-DSP_Siw14 | 37 | 184 | - | - | |
Bpe15g00169 | 196 | Pfam | Tyrosine phosphatase family | 39 | 193 | IPR004861 | - | |
Bpe15g00169 | 196 | Gene3D | Protein tyrosine phosphatase superfamily | 37 | 187 | IPR029021 | - | |
Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 94 | 108 | IPR020428 | GO:0016791 | |
Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 111 | 125 | IPR020428 | GO:0016791 | |
Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 75 | 88 | IPR020428 | GO:0016791 | |
Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 38 | 55 | IPR020428 | GO:0016791 | |
Bpe15g00169 | 196 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 39 | 184 | IPR029021 | - | |
Bpe15g00169 | 196 | PANTHER | - | 22 | 190 | - | - | |
Bpe15g00169 | 196 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 22 | 190 | - | - | |
Bpe15g00169 | 196 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 133 | 143 | IPR016130 | GO:0016311|GO:0016791 | |
Bpe15g00169 | 196 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 43 | 196 | IPR020422 | GO:0006470|GO:0008138 |
Event-related genes

Select | Gene_1 | Gene_2 | Event_name |
---|---|---|---|
Bpe14g00621 | Bpe15g00169 | CCT | |
Bpe12g00275 | Bpe15g00169 | BCT |
Duplication type information

Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
---|---|---|---|---|---|---|
Bpe14g00621 | Bpe-Chr14:5131870 | Bpe15g00169 | Bpe-Chr15:12184162 | 1.92E-97 | dispersed | |
Bpe14g00022 | Bpe-Chr14:430444 | Bpe15g00169 | Bpe-Chr15:12184162 | 1.91E-73 | transposed | |
Bpe12g00275 | Bpe-Chr12:2961721 | Bpe15g00169 | Bpe-Chr15:12184162 | 4.42E-101 | wgd |
Pathway information

Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Bpe15g00169 | K18045 | - | ming:122083976 | 295.434 |